PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G176600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 275aa    MW: 30005.5 Da    PI: 6.7928
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G176600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd+ lv  ++++G g+W++ ++  g+ R++k+c++rw +yl
  Sevir.7G176600.1.p 14 KGPWTPEEDKVLVAHIQRFGHGNWRALPKQAGLLRCGKSCRLRWINYL 61
                        79******************************99************97 PP

2Myb_DNA-binding53.55.5e-1767112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++++eE++ ++++++qlG++ W++Ia++++ gRt++++k+ w+++l
  Sevir.7G176600.1.p  67 RGNFSKEEEDAIIRLHEQLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                         89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129415.728961IPR017930Myb domain
SuperFamilySSF466893.67E-3110108IPR009057Homeodomain-like
SMARTSM007177.6E-131363IPR001005SANT/Myb domain
PfamPF002499.7E-151461IPR001005SANT/Myb domain
CDDcd001672.53E-101661No hitNo description
PROSITE profilePS5129425.60462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2665116IPR009057Homeodomain-like
SMARTSM007171.4E-1566114IPR001005SANT/Myb domain
PfamPF002491.4E-1567112IPR001005SANT/Myb domain
CDDcd001679.17E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTPE EDKVLVAHIQ RFGHGNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF SKEEEDAIIR LHEQLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLEPTK  120
QEEAQREAPA AGGGGKKRRP AAPAKRSGAR RAATDAATEA AAAAAPVSSP ERSASSSVTE  180
SSVTEQGNTG SSSGFPKEES FTSSPPDAEE FQFDESFWSE TLSMPLESFD VPMEPVDAFG  240
AAATSSAVGA ADDMDYWLRV FMESGDVHQE LPQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0398841e-161BT039884.1 Zea mays full-length cDNA clone ZM_BFc0049A07 mRNA, complete cds.
GenBankHQ8587091e-161HQ858709.1 Zea mays clone UT1165 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976230.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-114MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLK3Y9C20.0K3Y9C2_SETIT; Uncharacterized protein
STRINGSi010814m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-75myb domain protein 15